- Recombinant Nematostella vectensis Zinc finger protein-like 1 homolog (zfpl1)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1094198
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 28,495 Da
- E Coli or Yeast
- 1-252
- Zinc finger protein-like 1 homolog (zfpl1)
Sequence
MGLCKCPKKKVTNQFCFEHRVNVCEYCLVSSHSRCIVKSYLHWLQDSDYNPVCTLCNGNLSDGDVVRLICYDVFHLSCINNFAQSLPPNTAPAGYTCPNCKNGIFPPEKMVSPVVEQLKQKLSATSWAKAGLGIPVAPLEPLLFSSTVSRKIPEKRPEESLNTSVDHDENKYQRRGAIDWFSRWFGNRVNTKKQTYDDPNASLKRTMMIFFLVILAFVTVTVIFTRVGRNAAANDPFLDPRSNPHIRVEKDS